Lineage for d1m9fd_ (1m9f D:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1273716Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 1273717Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) (S)
  5. 1273718Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)
  6. 1273757Protein HIV-1 capsid protein [47945] (1 species)
  7. 1273758Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (25 PDB entries)
  8. 1273766Domain d1m9fd_: 1m9f D: [84901]
    Other proteins in same PDB: d1m9fa_, d1m9fb_

Details for d1m9fd_

PDB Entry: 1m9f (more details), 1.73 Å

PDB Description: x-ray crystal structure of cyclophilin a/hiv-1 ca n-terminal domain (1-146) m-type h87a,a88m complex.
PDB Compounds: (D:) hiv-1 capsid

SCOPe Domain Sequences for d1m9fd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9fd_ a.73.1.1 (D:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
hqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvgghqaamqmlke
tineeaaewdrlhpvamgpiapgqmreprgsdiagttstlqeqigwmthnppipvgeiyk
rwiilglnkivrmys

SCOPe Domain Coordinates for d1m9fd_:

Click to download the PDB-style file with coordinates for d1m9fd_.
(The format of our PDB-style files is described here.)

Timeline for d1m9fd_: