Lineage for d1m9cc_ (1m9c C:)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 772125Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
    core: 5 helices; bundle
  4. 772126Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (1 family) (S)
  5. 772127Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (5 proteins)
  6. 772141Protein HIV-1 capsid protein [47945] (1 species)
  7. 772142Species Human immunodeficiency virus type 1 [TaxId:11676] [47946] (15 PDB entries)
  8. 772158Domain d1m9cc_: 1m9c C: [84888]
    Other proteins in same PDB: d1m9ca_, d1m9cb_

Details for d1m9cc_

PDB Entry: 1m9c (more details), 2 Å

PDB Description: X-ray crystal structure of Cyclophilin A/HIV-1 CA N-terminal domain (1-146) M-type Complex.
PDB Compounds: (C:) hiv-1 capsid

SCOP Domain Sequences for d1m9cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9cc_ a.73.1.1 (C:) HIV-1 capsid protein {Human immunodeficiency virus type 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlnawvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmys

SCOP Domain Coordinates for d1m9cc_:

Click to download the PDB-style file with coordinates for d1m9cc_.
(The format of our PDB-style files is described here.)

Timeline for d1m9cc_: