Lineage for d1m9cb_ (1m9c B:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 379249Fold b.62: Cyclophilin (peptidylprolyl isomerase) [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 379250Superfamily b.62.1: Cyclophilin (peptidylprolyl isomerase) [50891] (1 family) (S)
  5. 379251Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (3 proteins)
  6. 379258Protein Cyclophilin (eukaryotic) [50893] (9 species)
  7. 379271Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (42 PDB entries)
  8. 379315Domain d1m9cb_: 1m9c B: [84887]
    Other proteins in same PDB: d1m9cc_, d1m9cd_

Details for d1m9cb_

PDB Entry: 1m9c (more details), 2 Å

PDB Description: X-ray crystal structure of Cyclophilin A/HIV-1 CA N-terminal domain (1-146) M-type Complex.

SCOP Domain Sequences for d1m9cb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9cb_ b.62.1.1 (B:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A}
nptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgfmc
qggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictaktewl
dgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1m9cb_:

Click to download the PDB-style file with coordinates for d1m9cb_.
(The format of our PDB-style files is described here.)

Timeline for d1m9cb_: