Lineage for d1m9ca_ (1m9c A:)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 674493Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 674494Superfamily b.62.1: Cyclophilin-like [50891] (3 families) (S)
  5. 674495Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (12 proteins)
  6. 674496Protein Cyclophilin (eukaryotic) [50893] (13 species)
  7. 674513Species Human (Homo sapiens), variant A [TaxId:9606] [50894] (48 PDB entries)
  8. 674572Domain d1m9ca_: 1m9c A: [84886]
    Other proteins in same PDB: d1m9cc_, d1m9cd_

Details for d1m9ca_

PDB Entry: 1m9c (more details), 2 Å

PDB Description: X-ray crystal structure of Cyclophilin A/HIV-1 CA N-terminal domain (1-146) M-type Complex.
PDB Compounds: (A:) cyclophilin a

SCOP Domain Sequences for d1m9ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9ca_ b.62.1.1 (A:) Cyclophilin (eukaryotic) {Human (Homo sapiens), variant A [TaxId: 9606]}
mvnptvffdiavdgeplgrvsfelfadkvpktaenfralstgekgfgykgscfhriipgf
mcqggdftrhngtggksiygekfedenfilkhtgpgilsmanagpntngsqffictakte
wldgkhvvfgkvkegmniveamerfgsrngktskkitiadcgqle

SCOP Domain Coordinates for d1m9ca_:

Click to download the PDB-style file with coordinates for d1m9ca_.
(The format of our PDB-style files is described here.)

Timeline for d1m9ca_: