Lineage for d1m9aa1 (1m9a A:81-216)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 915607Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 915608Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 915609Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 915620Protein Class alpha GST [81349] (8 species)
  7. 915717Species Schistosoma japonicum [TaxId:6182] [47633] (12 PDB entries)
    Uniprot P08515
  8. 915720Domain d1m9aa1: 1m9a A:81-216 [84882]
    Other proteins in same PDB: d1m9aa2
    complexed with gtx

Details for d1m9aa1

PDB Entry: 1m9a (more details), 2.1 Å

PDB Description: Crystal structure of the 26 kDa glutathione S-transferase from Schistosoma japonicum complexed with S-hexylglutathione
PDB Compounds: (A:) Glutathione S-Transferase 26 kDa

SCOPe Domain Sequences for d1m9aa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m9aa1 a.45.1.1 (A:81-216) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

SCOPe Domain Coordinates for d1m9aa1:

Click to download the PDB-style file with coordinates for d1m9aa1.
(The format of our PDB-style files is described here.)

Timeline for d1m9aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m9aa2