SCOPe 2.01: Domain d1m9aa1: 1m9a A:81-216

Lineage for d1m9aa1 (1m9a A:81-216)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (12 PDB entries)
   Uniprot P08515

8. Domain d1m9aa1: 1m9a A:81-216 [84882]
   Other proteins in same PDB: d1m9aa2
   complexed with gtx

Details for d1m9aa1

PDB Entry: 1m9a, 2.1 Å

PDB Description: Crystal structure of the 26 kDa glutathione S-transferase from Schistosoma japonicum complexed with S-hexylglutathione

PDB Compounds: (A:) Glutathione S-Transferase 26 kDa

SCOPe Domain Sequences for d1m9aa1:

Sequence; same for both SEQRES and ATOM records:

>d1m9aa1 a.45.1.1 (A:81-216) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

Timeline for d1m9aa1:

• d1m9aa1 first appeared in SCOP 1.65
  
• d1m9aa1 appears in SCOP 1.75
  
• d1m9aa1 appears in SCOPe 2.02
  
• d1m9aa1 appears in the current release, SCOPe 2.08