SCOPe 2.03: Domain d1m99a1: 1m99 A:81-216

Lineage for d1m99a1 (1m99 A:81-216)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class alpha GST [81349] (8 species)

7. Species Schistosoma japonicum [TaxId:6182] [47633] (14 PDB entries)
   Uniprot P08515

8. Domain d1m99a1: 1m99 A:81-216 [84880]
   Other proteins in same PDB: d1m99a2
   complexed with gts

Details for d1m99a1

PDB Entry: 1m99, 2.3 Å

PDB Description: Crystal structure of the 26 kDa glutathione S-transferase from Schistosoma japonicum complexed with glutathione sulfonic acid

PDB Compounds: (A:) Glutathione S-Transferase 26kDa

SCOPe Domain Sequences for d1m99a1:

Sequence; same for both SEQRES and ATOM records:

>d1m99a1 a.45.1.1 (A:81-216) Class alpha GST {Schistosoma japonicum [TaxId: 6182]}
mlggcpkeraeismlegavldirygvsriayskdfetlkvdflsklpemlkmfedrlchk
tylngdhvthpdfmlydaldvvlymdpmcldafpklvcfkkrieaipqidkylksskyia
wplqgwqatfgggdhp

Timeline for d1m99a1:

• d1m99a1 first appeared in SCOP 1.65
  
• d1m99a1 appears in SCOPe 2.02
  
• d1m99a1 appears in SCOPe 2.04
  
• d1m99a1 appears in the current release, SCOPe 2.08