SCOPe 2.04: Domain d1m8kb_: 1m8k B:

Lineage for d1m8kb_ (1m8k B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
   core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families)

5. Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)

6. Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (7 species)

7. Species Methanobacterium thermoautotrophicum [TaxId:145262] [63975] (6 PDB entries)

8. Domain d1m8kb_: 1m8k B: [84877]
   complexed with nad, so4; mutant

Details for d1m8kb_

PDB Entry: 1m8k, 3 Å

PDB Description: crystal structure of methanobacterium thermoautotrophicum nicotinamide mononucleotide adenylyltransferase mutant h19a complexed with nad

PDB Compounds: (B:) Nicotinamide-nucleotide Adenylyltransferase

SCOPe Domain Sequences for d1m8kb_:

Sequence; same for both SEQRES and ATOM records:

>d1m8kb_ c.26.1.3 (B:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
tmrgllvgrmqpfhrgalqviksileevdeliicigsaqlshsirdpftagervmmltka
lsengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtap
plfyrdrysgtevrrrmlddgdwrsllpesvvevideingverikhlak

Timeline for d1m8kb_:

• d1m8kb_ first appeared in SCOP 1.65
  
• d1m8kb_ appears in SCOPe 2.03
  
• d1m8kb_ appears in SCOPe 2.05
  
• d1m8kb_ appears in the current release, SCOPe 2.08, called d1m8kb1