Lineage for d1m8ja_ (1m8j A:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1841351Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 1841352Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 1841638Family c.26.1.3: Adenylyltransferase [52397] (6 proteins)
  6. 1841667Protein Nicotinamide mononucleotide (NMN) adenylyltransferase [52400] (8 species)
  7. 1841722Species Methanobacterium thermoautotrophicum [TaxId:145262] [63975] (6 PDB entries)
  8. 1841727Domain d1m8ja_: 1m8j A: [84875]
    complexed with nad, so4; mutant

Details for d1m8ja_

PDB Entry: 1m8j (more details), 2.4 Å

PDB Description: crystal structure of methanobacterium thermoautotrophicum nicotinamide mononucleotide adenylyltransferase mutant r136a complexed with nad
PDB Compounds: (A:) Nicotinamide-nucleotide Adenylyltransferase

SCOPe Domain Sequences for d1m8ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m8ja_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Methanobacterium thermoautotrophicum [TaxId: 145262]}
mrgllvgrmqpfhrghlqviksileevdeliicigsaqlshsirdpftagervmmltkal
sengipasryyiipvqdiecnalwvghikmltppfdrvysgnplvqrlfsedgyevtapp
lfyrdrysgtevarrmlddgdwrsllpesvvevideingverikhla

SCOPe Domain Coordinates for d1m8ja_:

Click to download the PDB-style file with coordinates for d1m8ja_.
(The format of our PDB-style files is described here.)

Timeline for d1m8ja_: