Lineage for d1m7wc_ (1m7w C:)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1097039Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 1097040Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 1097041Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 1097312Protein Hepatocyte nuclear factor 4-alpha [109605] (2 species)
  7. 1097315Species Norway rat (Rattus norvegicus) [TaxId:10116] [89146] (1 PDB entry)
  8. 1097318Domain d1m7wc_: 1m7w C: [84871]
    complexed with dao

Details for d1m7wc_

PDB Entry: 1m7w (more details), 2.8 Å

PDB Description: HNF4a ligand binding domain with bound fatty acid
PDB Compounds: (C:) Hepatocyte nuclear factor 4-alpha

SCOPe Domain Sequences for d1m7wc_:

Sequence, based on SEQRES records: (download)

>d1m7wc_ a.123.1.1 (C:) Hepatocyte nuclear factor 4-alpha {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lpsinallqaevlsqqitspisgingdirakriasitdvcesmkeqllvlvewakyipaf
celllddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsiri
ldelvlpfqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqy
dsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllg

Sequence, based on observed residues (ATOM records): (download)

>d1m7wc_ a.123.1.1 (C:) Hepatocyte nuclear factor 4-alpha {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lpsinallqaevlsqqitsirakriasitdvcesmkeqllvlvewakyipafcelllddq
vallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirildelvlpf
qelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsrgrfge
lllllptlqsitwqmieqiqfiklfgmakidnllqemllg

SCOPe Domain Coordinates for d1m7wc_:

Click to download the PDB-style file with coordinates for d1m7wc_.
(The format of our PDB-style files is described here.)

Timeline for d1m7wc_: