SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1m7wc_ (1m7w C:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2008476Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2008477Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2008478Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 protein domains)
  6. 2008783Protein Hepatocyte nuclear factor 4-alpha [109605] (2 species)
  7. 2008786Species Norway rat (Rattus norvegicus) [TaxId:10116] [89146] (1 PDB entry)
  8. 2008789Domain d1m7wc_: 1m7w C: [84871]
    complexed with dao

Details for d1m7wc_

PDB Entry: 1m7w (more details), 2.8 Å

PDB Description: HNF4a ligand binding domain with bound fatty acid
PDB Compounds: (C:) Hepatocyte nuclear factor 4-alpha

SCOPe Domain Sequences for d1m7wc_:

Sequence, based on SEQRES records: (download)

>d1m7wc_ a.123.1.1 (C:) Hepatocyte nuclear factor 4-alpha {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lpsinallqaevlsqqitspisgingdirakriasitdvcesmkeqllvlvewakyipaf
celllddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsiri
ldelvlpfqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqy
dsrgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllg

Sequence, based on observed residues (ATOM records): (download)

>d1m7wc_ a.123.1.1 (C:) Hepatocyte nuclear factor 4-alpha {Norway rat (Rattus norvegicus) [TaxId: 10116]}
lpsinallqaevlsqqitsirakriasitdvcesmkeqllvlvewakyipafcelllddq
vallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirildelvlpf
qelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsrgrfge
lllllptlqsitwqmieqiqfiklfgmakidnllqemllg

SCOPe Domain Coordinates for d1m7wc_:

Click to download the PDB-style file with coordinates for d1m7wc_.
(The format of our PDB-style files is described here.)

Timeline for d1m7wc_: