Lineage for d1m7wa_ (1m7w A:)

  1. Root: SCOP 1.65
  2. 275720Class a: All alpha proteins [46456] (179 folds)
  3. 285381Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 285382Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (1 family) (S)
  5. 285383Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (25 proteins)
  6. 285438Protein Hepatocyte nuclear factor 4-gamma [81918] (2 species)
  7. 285441Species Rat (Rattus norvegicus) [TaxId:10116] [89146] (1 PDB entry)
  8. 285442Domain d1m7wa_: 1m7w A: [84869]

Details for d1m7wa_

PDB Entry: 1m7w (more details), 2.8 Å

PDB Description: HNF4a ligand binding domain with bound fatty acid

SCOP Domain Sequences for d1m7wa_:

Sequence, based on SEQRES records: (download)

>d1m7wa_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-gamma {Rat (Rattus norvegicus)}
sinallqaevlsqqitspisgingdirakriasitdvcesmkeqllvlvewakyipafce
lllddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirild
elvlpfqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqyds
rgrfgelllllptlqsitwqmieqiqfiklfgmakidnllqemllg

Sequence, based on observed residues (ATOM records): (download)

>d1m7wa_ a.123.1.1 (A:) Hepatocyte nuclear factor 4-gamma {Rat (Rattus norvegicus)}
sinallqaevlsqqitspisgdirakriasitdvcesmkeqllvlvewakyipafcelll
ddqvallrahagehlllgatkrsmvfkdvlllgndyivprhcpelaemsrvsirildelv
lpfqelqiddneyaclkaiiffdpdakglsdpgkikrlrsqvqvsledyindrqydsrgr
fgelllllptlqsitwqmieqiqfiklfgmakidnllqemllg

SCOP Domain Coordinates for d1m7wa_:

Click to download the PDB-style file with coordinates for d1m7wa_.
(The format of our PDB-style files is described here.)

Timeline for d1m7wa_: