Lineage for d1m7ib2 (1m7i B:114-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655779Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (8 PDB entries)
  8. 655782Domain d1m7ib2: 1m7i B:114-213 [84868]
    Other proteins in same PDB: d1m7ia1, d1m7ia2, d1m7ib1
    part of Fab specific for Y lipopolysaccharide
    complexed with nag, raa, rao

Details for d1m7ib2

PDB Entry: 1m7i (more details), 2.5 Å

PDB Description: crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide complexed with a pentasaccharide
PDB Compounds: (B:) heavy chain of the monoclonal antibody Fab SYA/J6

SCOP Domain Sequences for d1m7ib2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ib2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3 [TaxId: 10090]}
atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg
fyslsslvtvpsstwpsqtvicnvahpaskvdlikepsgp

SCOP Domain Coordinates for d1m7ib2:

Click to download the PDB-style file with coordinates for d1m7ib2.
(The format of our PDB-style files is described here.)

Timeline for d1m7ib2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m7ib1