SCOP 1.73: Domain d1m7ia1: 1m7i A:1-108

Lineage for d1m7ia1 (1m7i A:1-108)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.1 [TaxId:10090] [88524] (127 PDB entries)

8. Domain d1m7ia1: 1m7i A:1-108 [84865]
   Other proteins in same PDB: d1m7ia2, d1m7ib1, d1m7ib2
   part of Fab specific for Y lipopolysaccharide
   complexed with nag, raa, rao

Details for d1m7ia1

PDB Entry: 1m7i, 2.5 Å

PDB Description: crystal structure of a monoclonal fab specific for shigella flexneri y lipopolysaccharide complexed with a pentasaccharide

PDB Compounds: (A:) light chain of the monoclonal antibody Fab SYA/J6

SCOP Domain Sequences for d1m7ia1:

Sequence; same for both SEQRES and ATOM records:

>d1m7ia1 b.1.1.1 (A:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.1 [TaxId: 10090]}
dvvltqtplslpvrlgdqasiscrssqsllhsdgntylhwylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqtthvptfgggtkleikr

Timeline for d1m7ia1:

• d1m7ia1 first appeared in SCOP 1.65
  
• d1m7ia1 appears in SCOP 1.71
  
• d1m7ia1 appears in SCOP 1.75
  
• d1m7ia1 appears in the current release, SCOPe 2.08