![]() | Class b: All beta proteins [48724] (126 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
![]() | Species Mouse (Mus musculus), gamma3 [TaxId:10090] [88577] (5 PDB entries) |
![]() | Domain d1m7db2: 1m7d B:114-213 [84864] Other proteins in same PDB: d1m7da1, d1m7da2, d1m7db1 part of Fab specific for Y lipopolysaccharide complexed with 1na, raa, rae |
PDB Entry: 1m7d (more details), 2.3 Å
SCOP Domain Sequences for d1m7db2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m7db2 b.1.1.2 (B:114-213) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus), gamma3} atttapsvyplvpgcsdtsgssvtlgclvkgyfpepvtvkwnygalssgvrtvssvlqsg fyslsslvtvpsstwpsqtvicnvahpaskvdlikepsgp
Timeline for d1m7db2: