Lineage for d1m7ab_ (1m7a B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1871769Fold c.71: Dihydrofolate reductase-like [53596] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest
  4. 1871770Superfamily c.71.1: Dihydrofolate reductase-like [53597] (3 families) (S)
  5. 1871771Family c.71.1.1: Dihydrofolate reductases [53598] (4 proteins)
  6. 1871959Protein Dihydrofolate reductases, eukaryotic type [53605] (7 species)
  7. 1872089Species Yeast (Candida albicans) [TaxId:5476] [53609] (17 PDB entries)
  8. 1872097Domain d1m7ab_: 1m7a B: [84860]
    complexed with mqu, ndp

Details for d1m7ab_

PDB Entry: 1m7a (more details), 1.76 Å

PDB Description: candida albicans dihydrofolate reductase complexed with dihydro- nicotinamide-adenine-dinucleotide phosphate (nadph) and 7-[2-methoxy- 1-(methoxymethyl)ethyl]-7h-pyrrolo[3,2-f] quinazoline-1,3-diamine (gw557)
PDB Compounds: (B:) dihydrofolate reductase

SCOPe Domain Sequences for d1m7ab_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m7ab_ c.71.1.1 (B:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans) [TaxId: 5476]}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

SCOPe Domain Coordinates for d1m7ab_:

Click to download the PDB-style file with coordinates for d1m7ab_.
(The format of our PDB-style files is described here.)

Timeline for d1m7ab_: