SCOP 1.65: Domain d1m7aa_: 1m7a A:

Lineage for d1m7aa_ (1m7a A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.71: Dihydrofolate reductases [53596] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 8 strands, order 34251687; strand 8 is antiparallel to the rest

4. Superfamily c.71.1: Dihydrofolate reductases [53597] (1 family)

5. Family c.71.1.1: Dihydrofolate reductases [53598] (3 proteins)

6. Protein Dihydrofolate reductases, eukaryotic type [53605] (4 species)

7. Species Yeast (Candida albicans) [TaxId:5476] [53609] (9 PDB entries)

8. Domain d1m7aa_: 1m7a A: [84859]

Details for d1m7aa_

PDB Entry: 1m7a, 1.76 Å

PDB Description: candida albicans dihydrofolate reductase complexed with dihydro- nicotinamide-adenine-dinucleotide phosphate (nadph) and 7-[2-methoxy- 1-(methoxymethyl)ethyl]-7h-pyrrolo[3,2-f] quinazoline-1,3-diamine (gw557)

SCOP Domain Sequences for d1m7aa_:

Sequence; same for both SEQRES and ATOM records:

>d1m7aa_ c.71.1.1 (A:) Dihydrofolate reductases, eukaryotic type {Yeast (Candida albicans)}
mlkpnvaiivaalkpalgigykgkmpwrlrkeiryfkdvttrttkpntrnavimgrktwe
sipqkfrplpdrlniilsrsyeneiiddniihassiesslnlvsdvervfiiggaeiyne
linnslvshlliteiehpspesiemdtflkfpleswtkqpkselqkfvgdtvleddikeg
dftynytlwtrk

Timeline for d1m7aa_:

• d1m7aa_ is new in SCOP 1.65
  
• d1m7aa_ appears in SCOP 1.67
  
• d1m7aa_ appears in the current release, SCOPe 2.08