Lineage for d1m71a2 (1m71 A:109-211)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 365639Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 365760Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries)
  8. 366026Domain d1m71a2: 1m71 A:109-211 [84852]
    Other proteins in same PDB: d1m71a1, d1m71b1, d1m71b2
    part of Fab specific for Y lipopolysaccharide

Details for d1m71a2

PDB Entry: 1m71 (more details), 2.8 Å

PDB Description: Crystal structure of a Monoclonal Fab Specific for Shigella Flexneri Y lipopolysaccharide

SCOP Domain Sequences for d1m71a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m71a2 b.1.1.2 (A:109-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnr

SCOP Domain Coordinates for d1m71a2:

Click to download the PDB-style file with coordinates for d1m71a2.
(The format of our PDB-style files is described here.)

Timeline for d1m71a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m71a1