![]() | Class b: All beta proteins [48724] (141 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
![]() | Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries) |
![]() | Domain d1m71a2: 1m71 A:109-211 [84852] Other proteins in same PDB: d1m71a1, d1m71b1, d1m71b2 part of Fab specific for Y lipopolysaccharide |
PDB Entry: 1m71 (more details), 2.8 Å
SCOP Domain Sequences for d1m71a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m71a2 b.1.1.2 (A:109-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d1m71a2: