SCOPe 2.08: Domain d1m6db_: 1m6d B:

Lineage for d1m6db_ (1m6d B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (24 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (26 proteins)

6. Protein Cathepsin F [89805] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89806] (1 PDB entry)

8. Domain d1m6db_: 1m6d B: [84850]
   complexed with myp

Details for d1m6db_

PDB Entry: 1m6d, 1.7 Å

PDB Description: crystal structure of human cathepsin f

PDB Compounds: (B:) Cathepsin F

SCOPe Domain Sequences for d1m6db_:

Sequence; same for both SEQRES and ATOM records:

>d1m6db_ d.3.1.1 (B:) Cathepsin F {Human (Homo sapiens) [TaxId: 9606]}
appewdwrskgavtkvkdqgmcgscwafsvtgnvegqwflnqgtllslseqelldcdkmd
kacmgglpsnaysaiknlggleteddysyqghmqscqfsaekakvyiqdsvelsqneqkl
aawlakrgpisvainafgmqfyrhgisrplrplcspwlidhavllvgygqrsdvpfwaik
nswgtdwgekgyyylhrgsgacgvntmassavvd

Timeline for d1m6db_:

• d1m6db_ first appeared in SCOP 1.65
  
• d1m6db_ appears in SCOPe 2.07