Lineage for d1m68a_ (1m68 A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 309983Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 310042Superfamily c.6.3: PHP domain [89550] (1 family) (S)
    contains trinuclear metal-binding site; some similarity to the metallohydrolases of TIM-barrel fold
  5. 310043Family c.6.3.1: PHP domain [89551] (1 protein)
    putative phosphoesterase domain
  6. 310044Protein Hypothetical protein YcdX [89552] (1 species)
  7. 310045Species Escherichia coli [TaxId:562] [89553] (2 PDB entries)
  8. 310047Domain d1m68a_: 1m68 A: [84848]
    structural genomics
    complexed with so4, zn

Details for d1m68a_

PDB Entry: 1m68 (more details), 2.3 Å

PDB Description: ycdx protein, trinuclear zinc site

SCOP Domain Sequences for d1m68a_:

Sequence, based on SEQRES records: (download)

>d1m68a_ c.6.3.1 (A:) Hypothetical protein YcdX {Escherichia coli}
ypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwpr
vvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiati
asgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssflhsrkgsedncrevaaavr
daggwvalgsdshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapiae
fadl

Sequence, based on observed residues (ATOM records): (download)

>d1m68a_ c.6.3.1 (A:) Hypothetical protein YcdX {Escherichia coli}
ypvdlhmhtvasthaystlsdyiaqakqkgiklfaitdhgpdmedaphhwhfinmriwpr
vvdgvgilrgieaniknvdgeidcsgkmfdsldliiagfhepvfaphdkatntqamiati
asgnvhiishpgnpkyeidvkavaeaaakhqvaleinnssncrevaaavrdaggwvalgs
dshtaftmgefeeclkildavdfpperilnvsprrllnflesrgmapiaefadl

SCOP Domain Coordinates for d1m68a_:

Click to download the PDB-style file with coordinates for d1m68a_.
(The format of our PDB-style files is described here.)

Timeline for d1m68a_: