Lineage for d1m61a_ (1m61 A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 332255Fold d.93: SH2-like [55549] (1 superfamily)
    3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flaked by two helices
  4. 332256Superfamily d.93.1: SH2 domain [55550] (1 family) (S)
  5. 332257Family d.93.1.1: SH2 domain [55551] (25 proteins)
  6. 332482Protein Tyrosine-protein kinase zap-70 [89996] (1 species)
  7. 332483Species Human (Homo sapiens) [TaxId:9606] [89997] (1 PDB entry)
  8. 332484Domain d1m61a_: 1m61 A: [84846]
    complexed with po4

Details for d1m61a_

PDB Entry: 1m61 (more details), 2.5 Å

PDB Description: crystal structure of the apo sh2 domains of zap-70

SCOP Domain Sequences for d1m61a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m61a_ d.93.1.1 (A:) Tyrosine-protein kinase zap-70 {Human (Homo sapiens)}
gshmpdpaahlpffygsisraeaeehlklagmadglfllrqclrslggyvlslvhdvrfh
hfpierqlngtyaiaggkahcgpaelcefysrdpdglpcnlrkpcnrpsglepqpgvfdc
lrdamvrdyvrqtwklegealeqaiisqapqvekliattahermpwyhssltreeaerkl
ysgaqtdgkfllrprkeqgtyalsliygktvyhylisqdkagkycipegtkfdtlwqlve
ylklkadgliyclkeacpn

SCOP Domain Coordinates for d1m61a_:

Click to download the PDB-style file with coordinates for d1m61a_.
(The format of our PDB-style files is described here.)

Timeline for d1m61a_:

  • d1m61a_ is new in SCOP 1.65
  • d1m61a_ does not appear in SCOP 1.67