SCOP 1.73: Domain d1m5xb_: 1m5x B:

Lineage for d1m5xb_ (1m5x B:)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
   alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243

4. Superfamily d.95.2: Homing endonucleases [55608] (2 families)

5. Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins)
   contains two extra helices in the C-terminal extension

6. Protein DNA endonuclease I-MsoI [90006] (1 species)

7. Species Monomastix sp. cl-1997 [TaxId:141716] [90007] (1 PDB entry)

8. Domain d1m5xb_: 1m5x B: [84845]
   complexed with ca

Details for d1m5xb_

PDB Entry: 1m5x, 2.25 Å

PDB Description: crystal structure of the homing endonuclease i-msoi bound to its dna substrate

PDB Compounds: (B:) DNA endonuclease I-MsoI

SCOP Domain Sequences for d1m5xb_:

Sequence; same for both SEQRES and ATOM records:

>d1m5xb_ d.95.2.1 (B:) DNA endonuclease I-MsoI {Monomastix sp. cl-1997 [TaxId: 141716]}
tlqpteaayiagfldgdgsiyakliprpdykdikyqvslaisfiqrkdkfpylqdiydql
gkrgnlrkdrgdgiadytiigsthlsiilpdlvpylrikkkqanrilhiinlypqaqknp
skfldlvkivddvqnlnkradelkstnydrlleeflkagki

Timeline for d1m5xb_:

• d1m5xb_ first appeared in SCOP 1.65
  
• d1m5xb_ appears in SCOP 1.71
  
• d1m5xb_ appears in SCOP 1.75
  
• d1m5xb_ appears in the current release, SCOPe 2.08