Lineage for d1m5xa_ (1m5x A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730086Fold d.95: Homing endonuclease-like [55603] (2 superfamilies)
    alpha-beta(2)-alpha-beta(2)-alpha; 2 layers: a/b; antiparallel sheet 1243
  4. 730093Superfamily d.95.2: Homing endonucleases [55608] (2 families) (S)
  5. 730094Family d.95.2.1: Group I mobile intron endonuclease [55609] (5 proteins)
    contains two extra helices in the C-terminal extension
  6. 730138Protein DNA endonuclease I-MsoI [90006] (1 species)
  7. 730139Species Monomastix sp. cl-1997 [TaxId:141716] [90007] (1 PDB entry)
  8. 730140Domain d1m5xa_: 1m5x A: [84844]

Details for d1m5xa_

PDB Entry: 1m5x (more details), 2.25 Å

PDB Description: crystal structure of the homing endonuclease i-msoi bound to its dna substrate
PDB Compounds: (A:) DNA endonuclease I-MsoI

SCOP Domain Sequences for d1m5xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5xa_ d.95.2.1 (A:) DNA endonuclease I-MsoI {Monomastix sp. cl-1997 [TaxId: 141716]}
tlqpteaayiagfldgdgsiyakliprpdykdikyqvslaisfiqrkdkfpylqdiydql
gkrgnlrkdrgdgiadytiigsthlsiilpdlvpylrikkkqanrilhiinlypqaqknp
skfldlvkivddvqnlnkradelkstnydrlleeflkagki

SCOP Domain Coordinates for d1m5xa_:

Click to download the PDB-style file with coordinates for d1m5xa_.
(The format of our PDB-style files is described here.)

Timeline for d1m5xa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1m5xb_