Lineage for d1m5wg_ (1m5w G:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307837Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (1 family) (S)
  5. 307838Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (1 protein)
  6. 307839Protein Pyridoxine 5'-phosphate synthase [63894] (1 species)
  7. 307840Species Escherichia coli [TaxId:562] [63895] (7 PDB entries)
  8. 307847Domain d1m5wg_: 1m5w G: [84842]

Details for d1m5wg_

PDB Entry: 1m5w (more details), 1.96 Å

PDB Description: 1.96 A Crystal Structure of Pyridoxine 5'-Phosphate Synthase in Complex with 1-deoxy-D-xylulose phosphate

SCOP Domain Sequences for d1m5wg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5wg_ c.1.24.1 (G:) Pyridoxine 5'-phosphate synthase {Escherichia coli}
aelllgvnidhiatlrnargtaypdpvqaafiaeqagadgitvhlredrrhitdrdvril
rqtldtrmnlemavteemlaiavetkphfcclvpekrqevtteggldvagqrdkmrdack
rladagiqvslfidadeeqikaaaevgapfieihtgcyadaktdaeqaqelariakaatf
aaslglkvnaghgltyhnvkaiaaipemhelnighaiigravmtglkdavaemkrlmlea
rg

SCOP Domain Coordinates for d1m5wg_:

Click to download the PDB-style file with coordinates for d1m5wg_.
(The format of our PDB-style files is described here.)

Timeline for d1m5wg_: