Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (1 family) |
Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (1 protein) |
Protein Pyridoxine 5'-phosphate synthase [63894] (1 species) |
Species Escherichia coli [TaxId:562] [63895] (7 PDB entries) |
Domain d1m5wg_: 1m5w G: [84842] |
PDB Entry: 1m5w (more details), 1.96 Å
SCOP Domain Sequences for d1m5wg_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m5wg_ c.1.24.1 (G:) Pyridoxine 5'-phosphate synthase {Escherichia coli} aelllgvnidhiatlrnargtaypdpvqaafiaeqagadgitvhlredrrhitdrdvril rqtldtrmnlemavteemlaiavetkphfcclvpekrqevtteggldvagqrdkmrdack rladagiqvslfidadeeqikaaaevgapfieihtgcyadaktdaeqaqelariakaatf aaslglkvnaghgltyhnvkaiaaipemhelnighaiigravmtglkdavaemkrlmlea rg
Timeline for d1m5wg_: