Lineage for d1m5wf_ (1m5w F:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2840720Superfamily c.1.24: Pyridoxine 5'-phosphate synthase [63892] (2 families) (S)
  5. 2840721Family c.1.24.1: Pyridoxine 5'-phosphate synthase [63893] (2 proteins)
    automatically mapped to Pfam PF03740
  6. 2840722Protein Pyridoxine 5'-phosphate synthase [63894] (1 species)
  7. 2840723Species Escherichia coli [TaxId:562] [63895] (7 PDB entries)
  8. 2840729Domain d1m5wf_: 1m5w F: [84841]
    complexed with dxp, po4

Details for d1m5wf_

PDB Entry: 1m5w (more details), 1.96 Å

PDB Description: 1.96 A Crystal Structure of Pyridoxine 5'-Phosphate Synthase in Complex with 1-deoxy-D-xylulose phosphate
PDB Compounds: (F:) Pyridoxal phosphate biosynthetic protein pdxJ

SCOPe Domain Sequences for d1m5wf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5wf_ c.1.24.1 (F:) Pyridoxine 5'-phosphate synthase {Escherichia coli [TaxId: 562]}
aelllgvnidhiatlrnargtaypdpvqaafiaeqagadgitvhlredrrhitdrdvril
rqtldtrmnlemavteemlaiavetkphfcclvpekrqevtteggldvagqrdkmrdack
rladagiqvslfidadeeqikaaaevgapfieihtgcyadaktdaeqaqelariakaatf
aaslglkvnaghgltyhnvkaiaaipemhelnighaiigravmtglkdavaemkrlmlea
rg

SCOPe Domain Coordinates for d1m5wf_:

Click to download the PDB-style file with coordinates for d1m5wf_.
(The format of our PDB-style files is described here.)

Timeline for d1m5wf_: