Lineage for d1m5qz_ (1m5q Z:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2396390Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2396391Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2396392Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
    forms homo and heteroheptameric ring structures
    Pfam PF01423
  6. 2396654Protein Sm-Like archaeal protein Smap3 [89317] (1 species)
    contains additional C-terminal alpha+beta domain
  7. 2396655Species Pyrobaculum aerophilum [TaxId:13773] [89318] (1 PDB entry)
  8. 2396683Domain d1m5qz_: 1m5q Z: [84835]
    complexed with acy, cd, gol, na

Details for d1m5qz_

PDB Entry: 1m5q (more details), 2 Å

PDB Description: crystal structure of a novel sm-like archaeal protein from pyrobaculum aerophilum
PDB Compounds: (Z:) small nuclear ribonucleoprotein homolog

SCOPe Domain Sequences for d1m5qz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5qz_ b.38.1.1 (Z:) Sm-Like archaeal protein Smap3 {Pyrobaculum aerophilum [TaxId: 13773]}
fvaelnnllgrevqvvlsngevykgvlhavdnqlnivlanasnkagekfnrvfimyryiv
hidsterridmrefakqaekifpgmvkyieetnvvligdkvrvseigvegvgpvaerakr
lfeeflkr

SCOPe Domain Coordinates for d1m5qz_:

Click to download the PDB-style file with coordinates for d1m5qz_.
(The format of our PDB-style files is described here.)

Timeline for d1m5qz_: