Lineage for d1m5qz_ (1m5q Z:)

  1. Root: SCOP 1.65
  2. 287094Class b: All beta proteins [48724] (126 folds)
  3. 296506Fold b.38: Sm-like fold [50181] (2 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 296507Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (3 families) (S)
  5. 296508Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (7 proteins)
    forms homo and heteroheptameric ring structures
  6. 296685Protein Sm-Like archaeal protein Smap3 [89317] (1 species)
    contains additional C-terminal alpha+beta domain
  7. 296686Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [89318] (1 PDB entry)
  8. 296714Domain d1m5qz_: 1m5q Z: [84835]

Details for d1m5qz_

PDB Entry: 1m5q (more details), 2 Å

PDB Description: crystal structure of a novel sm-like archaeal protein from pyrobaculum aerophilum

SCOP Domain Sequences for d1m5qz_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m5qz_ b.38.1.1 (Z:) Sm-Like archaeal protein Smap3 {Archaeon Pyrobaculum aerophilum}
fvaelnnllgrevqvvlsngevykgvlhavdnqlnivlanasnkagekfnrvfimyryiv
hidsterridmrefakqaekifpgmvkyieetnvvligdkvrvseigvegvgpvaerakr
lfeeflkr

SCOP Domain Coordinates for d1m5qz_:

Click to download the PDB-style file with coordinates for d1m5qz_.
(The format of our PDB-style files is described here.)

Timeline for d1m5qz_: