SCOPe 2.05: Domain d1m4yc_: 1m4y C:

Lineage for d1m4yc_ (1m4y C:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (4 proteins)

6. Protein HslV (ClpQ) protease [56258] (4 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Thermotoga maritima [TaxId:2336] [90045] (1 PDB entry)

8. Domain d1m4yc_: 1m4y C: [84804]
   complexed with na

Details for d1m4yc_

PDB Entry: 1m4y, 2.1 Å

PDB Description: Crystal structure of HslV from Thermotoga maritima

PDB Compounds: (C:) ATP-dependent protease hslv

SCOPe Domain Sequences for d1m4yc_:

Sequence; same for both SEQRES and ATOM records:

>d1m4yc_ d.153.1.4 (C:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]}
ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrf
eaklrewggnltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaa
aigsggpyalaaakallrntdlsareivekamtiageiciytnqnivieev

Timeline for d1m4yc_:

• d1m4yc_ first appeared in SCOP 1.65
  
• d1m4yc_ appears in SCOPe 2.04
  
• d1m4yc_ appears in SCOPe 2.06
  
• d1m4yc_ appears in the current release, SCOPe 2.08