Lineage for d1m4yc_ (1m4y C:)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 512789Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 512790Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 512929Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 512930Protein HslV (ClpQ) protease [56258] (3 species)
    dodecameric prokaryotic homologue of proteasome
  7. 513010Species Thermotoga maritima [TaxId:243274] [90045] (1 PDB entry)
  8. 513013Domain d1m4yc_: 1m4y C: [84804]

Details for d1m4yc_

PDB Entry: 1m4y (more details), 2.1 Å

PDB Description: Crystal structure of HslV from Thermotoga maritima

SCOP Domain Sequences for d1m4yc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4yc_ d.153.1.4 (C:) HslV (ClpQ) protease {Thermotoga maritima}
ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrf
eaklrewggnltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaa
aigsggpyalaaakallrntdlsareivekamtiageiciytnqnivieev

SCOP Domain Coordinates for d1m4yc_:

Click to download the PDB-style file with coordinates for d1m4yc_.
(The format of our PDB-style files is described here.)

Timeline for d1m4yc_: