SCOP 1.71: Domain d1m4yb_: 1m4y B:

Lineage for d1m4yb_ (1m4y B:)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.4: Proteasome subunits [56251] (3 proteins)

6. Protein HslV (ClpQ) protease [56258] (3 species)
   dodecameric prokaryotic homologue of proteasome

7. Species Thermotoga maritima [TaxId:243274] [90045] (1 PDB entry)

8. Domain d1m4yb_: 1m4y B: [84803]

Details for d1m4yb_

PDB Entry: 1m4y, 2.1 Å

PDB Description: Crystal structure of HslV from Thermotoga maritima

SCOP Domain Sequences for d1m4yb_:

Sequence; same for both SEQRES and ATOM records:

>d1m4yb_ d.153.1.4 (B:) HslV (ClpQ) protease {Thermotoga maritima}
ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrf
eaklrewggnltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaa
aigsggpyalaaakallrntdlsareivekamtiageiciytnqnivieev

Timeline for d1m4yb_:

• d1m4yb_ first appeared in SCOP 1.65
  
• d1m4yb_ appears in SCOP 1.69
  
• d1m4yb_ appears in SCOP 1.73
  
• d1m4yb_ appears in the current release, SCOPe 2.08