Lineage for d1m4yb_ (1m4y B:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 335536Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 335537Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (5 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 335658Family d.153.1.4: Proteasome subunits [56251] (3 proteins)
  6. 335659Protein HslV (ClpQ) protease [56258] (3 species)
    dodecameric prokaryotic homologue of proteasome
  7. 335739Species Thermotoga maritima [TaxId:243274] [90045] (1 PDB entry)
  8. 335741Domain d1m4yb_: 1m4y B: [84803]

Details for d1m4yb_

PDB Entry: 1m4y (more details), 2.1 Å

PDB Description: Crystal structure of HslV from Thermotoga maritima
PDB Compounds: (B:)

SCOP Domain Sequences for d1m4yb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4yb_ d.153.1.4 (B:) HslV (ClpQ) protease {Thermotoga maritima}
ttilvvrrngqtvmggdgqvtfgstvlkgnarkvrklgegkvlagfagsvadamtlfdrf
eaklrewggnltkaavelakdwrtdrvlrrlealllvadkenifiisgngeviqpdddaa
aigsggpyalaaakallrntdlsareivekamtiageiciytnqnivieev

SCOP Domain Coordinates for d1m4yb_:

Click to download the PDB-style file with coordinates for d1m4yb_.
(The format of our PDB-style files is described here.)

Timeline for d1m4yb_: