Lineage for d1m4wa_ (1m4w A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2387948Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2387949Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2389728Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)
  6. 2389773Protein Xylanase II [49979] (21 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2389863Species Nonomuraea flexuosa [TaxId:103836] [89273] (1 PDB entry)
  8. 2389864Domain d1m4wa_: 1m4w A: [84801]
    complexed with act, gol

Details for d1m4wa_

PDB Entry: 1m4w (more details), 2.1 Å

PDB Description: thermophilic b-1,4-xylanase from nonomuraea flexuosa
PDB Compounds: (A:) endoxylanase

SCOPe Domain Sequences for d1m4wa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4wa_ b.29.1.11 (A:) Xylanase II {Nonomuraea flexuosa [TaxId: 103836]}
dttitqnqtgydngyfysfwtdapgtvsmtlhsggsystswrntgnfvagkgwstggrrt
vtynasfnpsgnayltlygwtrnplveyyiveswgtyrptgtykgtvttdggtydiyetw
rynapsiegtrtfqqfwsvrqqkrtsgtitignhfdawaragmnlgshdyqimategyqs
sgsstvsiseggnpgnp

SCOPe Domain Coordinates for d1m4wa_:

Click to download the PDB-style file with coordinates for d1m4wa_.
(The format of our PDB-style files is described here.)

Timeline for d1m4wa_: