Class b: All beta proteins [48724] (178 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins) |
Protein Xylanase II [49979] (21 species) Partial overlap with common fold and the active sites of the other endoglucanases |
Species Nonomuraea flexuosa [TaxId:103836] [89273] (1 PDB entry) |
Domain d1m4wa_: 1m4w A: [84801] complexed with act, gol |
PDB Entry: 1m4w (more details), 2.1 Å
SCOPe Domain Sequences for d1m4wa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4wa_ b.29.1.11 (A:) Xylanase II {Nonomuraea flexuosa [TaxId: 103836]} dttitqnqtgydngyfysfwtdapgtvsmtlhsggsystswrntgnfvagkgwstggrrt vtynasfnpsgnayltlygwtrnplveyyiveswgtyrptgtykgtvttdggtydiyetw rynapsiegtrtfqqfwsvrqqkrtsgtitignhfdawaragmnlgshdyqimategyqs sgsstvsiseggnpgnp
Timeline for d1m4wa_: