SCOPe 2.06: Domain d1m4wa_: 1m4w A:

Lineage for d1m4wa_ (1m4w A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein Xylanase II [49979] (19 species)
   Partial overlap with common fold and the active sites of the other endoglucanases

7. Species Nonomuraea flexuosa [TaxId:103836] [89273] (1 PDB entry)

8. Domain d1m4wa_: 1m4w A: [84801]
   complexed with act, gol

Details for d1m4wa_

PDB Entry: 1m4w, 2.1 Å

PDB Description: thermophilic b-1,4-xylanase from nonomuraea flexuosa

PDB Compounds: (A:) endoxylanase

SCOPe Domain Sequences for d1m4wa_:

Sequence; same for both SEQRES and ATOM records:

>d1m4wa_ b.29.1.11 (A:) Xylanase II {Nonomuraea flexuosa [TaxId: 103836]}
dttitqnqtgydngyfysfwtdapgtvsmtlhsggsystswrntgnfvagkgwstggrrt
vtynasfnpsgnayltlygwtrnplveyyiveswgtyrptgtykgtvttdggtydiyetw
rynapsiegtrtfqqfwsvrqqkrtsgtitignhfdawaragmnlgshdyqimategyqs
sgsstvsiseggnpgnp

Timeline for d1m4wa_:

• d1m4wa_ first appeared in SCOP 1.65
  
• d1m4wa_ appears in SCOPe 2.05
  
• d1m4wa_ appears in SCOPe 2.07
  
• d1m4wa_ appears in the current release, SCOPe 2.08