SCOPe 2.05: Domain d1m4rb_: 1m4r B:

Lineage for d1m4rb_ (1m4r B:)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.26: 4-helical cytokines [47265] (1 superfamily)
   core: 4 helices; bundle, closed; left-handed twist; 2 crossover connections

4. Superfamily a.26.1: 4-helical cytokines [47266] (4 families)
   there are two different topoisomers of this fold with different entanglements of the two crossover connections

5. Family a.26.1.3: Interferons/interleukin-10 (IL-10) [47305] (9 proteins)
   contains an additional helix in one of the crossover connections

6. Protein Interleukin-22 (IL-22) [89036] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89037] (5 PDB entries)

8. Domain d1m4rb_: 1m4r B: [84800]

Details for d1m4rb_

PDB Entry: 1m4r, 2 Å

PDB Description: crystal structure of recombinant human interleukin-22

PDB Compounds: (B:) Interleukin-22

SCOPe Domain Sequences for d1m4rb_:

Sequence; same for both SEQRES and ATOM records:

>d1m4rb_ a.26.1.3 (B:) Interleukin-22 (IL-22) {Human (Homo sapiens) [TaxId: 9606]}
hcrldksnfqqpyitnrtfmlakeasladnntdvrligeklfhgvsmsercylmkqvlnf
tleevlfpqsdrfqpymqevvpflarlsnrlstchiegddlhiqrnvqklkdtvkklges
geikaigeldllfmslrnaci

Timeline for d1m4rb_:

• d1m4rb_ first appeared in SCOP 1.65
  
• d1m4rb_ appears in SCOPe 2.04
  
• d1m4rb_ appears in SCOPe 2.06
  
• d1m4rb_ appears in the current release, SCOPe 2.08