Lineage for d1m4ka2 (1m4k A:104-200)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1518665Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 1518896Protein Killer cell inhibitory receptor [49202] (4 species)
    possibly an intermediate structure between the I set and FnIII domains
  7. 1518909Species Human (Homo sapiens), kir2ds3, CD158j [TaxId:9606] [89190] (1 PDB entry)
  8. 1518911Domain d1m4ka2: 1m4k A:104-200 [84797]
    complexed with edo, so4

Details for d1m4ka2

PDB Entry: 1m4k (more details), 2.3 Å

PDB Description: Crystal structure of the human natural killer cell activator receptor KIR2DS2 (CD158j)
PDB Compounds: (A:) killer cell immunoglobulin-like receptor 2ds2

SCOPe Domain Sequences for d1m4ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m4ka2 b.1.1.4 (A:104-200) Killer cell inhibitory receptor {Human (Homo sapiens), kir2ds3, CD158j [TaxId: 9606]}
lyekpslsaqpgptvlagesvtlscssrssydmyhlsregeaherrfsagpkvngtfqad
fplgpathggtyrcfgsfrdspyewsnssdpllvsvt

SCOPe Domain Coordinates for d1m4ka2:

Click to download the PDB-style file with coordinates for d1m4ka2.
(The format of our PDB-style files is described here.)

Timeline for d1m4ka2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m4ka1