SCOP 1.75: Domain d1m4ka1: 1m4k A:8-103

Lineage for d1m4ka1 (1m4k A:8-103)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.4: I set domains [49159] (38 proteins)

6. Protein Killer cell inhibitory receptor [49202] (4 species)
   possibly an intermediate structure between the I set and FnIII domains

7. Species Human (Homo sapiens), kir2ds3, CD158j [TaxId:9606] [89190] (1 PDB entry)

8. Domain d1m4ka1: 1m4k A:8-103 [84796]

Details for d1m4ka1

PDB Entry: 1m4k, 2.3 Å

PDB Description: Crystal structure of the human natural killer cell activator receptor KIR2DS2 (CD158j)

PDB Compounds: (A:) killer cell immunoglobulin-like receptor 2ds2

SCOP Domain Sequences for d1m4ka1:

Sequence; same for both SEQRES and ATOM records:

>d1m4ka1 b.1.1.4 (A:8-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2ds3, CD158j [TaxId: 9606]}
psllahpgplvkseetvilqcwsdvrfehfllhregkykdtlhligehhdgvskanfsig
pmmqdlagtyrcygsvthspyqlsapsdpldivitg

Timeline for d1m4ka1:

• d1m4ka1 first appeared in SCOP 1.65
  
• d1m4ka1 appears in SCOP 1.73
  
• d1m4ka1 appears in SCOPe 2.01
  
• d1m4ka1 appears in the current release, SCOPe 2.08