Class b: All beta proteins [48724] (174 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.4: I set domains [49159] (38 proteins) |
Protein Killer cell inhibitory receptor [49202] (4 species) possibly an intermediate structure between the I set and FnIII domains |
Species Human (Homo sapiens), kir2ds3, CD158j [TaxId:9606] [89190] (1 PDB entry) |
Domain d1m4ka1: 1m4k A:8-103 [84796] |
PDB Entry: 1m4k (more details), 2.3 Å
SCOP Domain Sequences for d1m4ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m4ka1 b.1.1.4 (A:8-103) Killer cell inhibitory receptor {Human (Homo sapiens), kir2ds3, CD158j [TaxId: 9606]} psllahpgplvkseetvilqcwsdvrfehfllhregkykdtlhligehhdgvskanfsig pmmqdlagtyrcygsvthspyqlsapsdpldivitg
Timeline for d1m4ka1: