Lineage for d1m3va2 (1m3v A:33-71)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3035586Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
    alpha+beta metal(zinc)-bound fold
  4. 3035587Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families) (S)
  5. 3035744Family g.39.1.3: LIM domain [57736] (18 proteins)
    duplication: contains two (sub)domains of this fold
  6. 3035817Protein LIM only 4 (Lmo4) [90205] (1 species)
  7. 3035818Species Mouse (Mus musculus) [TaxId:10090] [90206] (2 PDB entries)
    Uniprot P61969 19-152
  8. 3035824Domain d1m3va2: 1m3v A:33-71 [84795]
    fusion of the first LIM domain with a fragment of LIM domain binding protein 1, LMBP1, residues 83-122, connected with a linker, res. 72-82
    complexed with zn

Details for d1m3va2

PDB Entry: 1m3v (more details)

PDB Description: flin4: fusion of the lim binding domain of ldb1 and the n-terminal lim domain of lmo4
PDB Compounds: (A:) fusion of the LIM interacting domain of ldb1 and the N-terminal LIM domain of LMO4

SCOPe Domain Sequences for d1m3va2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3va2 g.39.1.3 (A:33-71) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]}
lkcsscqaqlgdigtssytksgmilcrndyirlfgnsga

SCOPe Domain Coordinates for d1m3va2:

Click to download the PDB-style file with coordinates for d1m3va2.
(The format of our PDB-style files is described here.)

Timeline for d1m3va2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m3va1