Lineage for d1m3uh_ (1m3u H:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 307114Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 307264Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (1 protein)
  6. 307265Protein Ketopantoate hydroxymethyltransferase PanB [89504] (2 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 307266Species Escherichia coli [TaxId:562] [89506] (1 PDB entry)
  8. 307274Domain d1m3uh_: 1m3u H: [84791]

Details for d1m3uh_

PDB Entry: 1m3u (more details), 1.8 Å

PDB Description: crystal structure of ketopantoate hydroxymethyltransferase complexed the product ketopantoate

SCOP Domain Sequences for d1m3uh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3uh_ c.1.12.8 (H:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli}
pttisllqkykqekkrfatitaydysfaklfadeglnvmlvgdslgmtvqghdstlpvtv
adiayhtaavrrgapncllladlpfmayatpeqafenaatvmraganmvkieggewlvet
vqmlteravpvcghlgltpqsvnifggykvqgrgdeagdqllsdalaleaagaqllvlec
vpvelakritealaipvigigagnvtdgqilvmhdafgitgghipkfaknflaetgdira
avrqymaevesgvypgeehsfh

SCOP Domain Coordinates for d1m3uh_:

Click to download the PDB-style file with coordinates for d1m3uh_.
(The format of our PDB-style files is described here.)

Timeline for d1m3uh_: