Lineage for d1m3uf_ (1m3u F:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1815292Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 1824470Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) (S)
  5. 1824734Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (2 proteins)
    automatically mapped to Pfam PF02548
  6. 1824735Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 1824736Species Escherichia coli [TaxId:562] [89506] (1 PDB entry)
  8. 1824742Domain d1m3uf_: 1m3u F: [84789]
    complexed with kpl, mg

Details for d1m3uf_

PDB Entry: 1m3u (more details), 1.8 Å

PDB Description: crystal structure of ketopantoate hydroxymethyltransferase complexed the product ketopantoate
PDB Compounds: (F:) 3-methyl-2-oxobutanoate hydroxymethyltransferase

SCOPe Domain Sequences for d1m3uf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3uf_ c.1.12.8 (F:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]}
pttisllqkykqekkrfatitaydysfaklfadeglnvmlvgdslgmtvqghdstlpvtv
adiayhtaavrrgapncllladlpfmayatpeqafenaatvmraganmvkieggewlvet
vqmlteravpvcghlgltpqsvnifggykvqgrgdeagdqllsdalaleaagaqllvlec
vpvelakritealaipvigigagnvtdgqilvmhdafgitgghipkfaknflaetgdira
avrqymaevesgvypgeehsfh

SCOPe Domain Coordinates for d1m3uf_:

Click to download the PDB-style file with coordinates for d1m3uf_.
(The format of our PDB-style files is described here.)

Timeline for d1m3uf_: