Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (8 families) |
Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (2 proteins) automatically mapped to Pfam PF02548 |
Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species) dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme |
Species Escherichia coli [TaxId:562] [89506] (1 PDB entry) |
Domain d1m3ub_: 1m3u B: [84785] complexed with kpl, mg |
PDB Entry: 1m3u (more details), 1.8 Å
SCOPe Domain Sequences for d1m3ub_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3ub_ c.1.12.8 (B:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli [TaxId: 562]} pttisllqkykqekkrfatitaydysfaklfadeglnvmlvgdslgmtvqghdstlpvtv adiayhtaavrrgapncllladlpfmayatpeqafenaatvmraganmvkieggewlvet vqmlteravpvcghlgltpqsvnifggykvqgrgdeagdqllsdalaleaagaqllvlec vpvelakritealaipvigigagnvtdgqilvmhdafgitgghipkfaknflaetgdira avrqymaevesgvypgeehsfh
Timeline for d1m3ub_: