Lineage for d1m3ua_ (1m3u A:)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 383642Fold c.1: TIM beta/alpha-barrel [51350] (28 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 386143Superfamily c.1.12: Phosphoenolpyruvate/pyruvate domain [51621] (6 families) (S)
  5. 386313Family c.1.12.8: Ketopantoate hydroxymethyltransferase PanB [89503] (1 protein)
  6. 386314Protein Ketopantoate hydroxymethyltransferase PanB [89504] (3 species)
    dodecameric enzyme; a C-terminal helix exchange is observed in the M. tuberculosis enzyme but not in the E. coli enzyme
  7. 386315Species Escherichia coli [TaxId:562] [89506] (1 PDB entry)
  8. 386316Domain d1m3ua_: 1m3u A: [84784]

Details for d1m3ua_

PDB Entry: 1m3u (more details), 1.8 Å

PDB Description: crystal structure of ketopantoate hydroxymethyltransferase complexed the product ketopantoate

SCOP Domain Sequences for d1m3ua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3ua_ c.1.12.8 (A:) Ketopantoate hydroxymethyltransferase PanB {Escherichia coli}
pttisllqkykqekkrfatitaydysfaklfadeglnvmlvgdslgmtvqghdstlpvtv
adiayhtaavrrgapncllladlpfmayatpeqafenaatvmraganmvkieggewlvet
vqmlteravpvcghlgltpqsvnifggykvqgrgdeagdqllsdalaleaagaqllvlec
vpvelakritealaipvigigagnvtdgqilvmhdafgitgghipkfaknflaetgdira
avrqymaevesgvypgeehsfh

SCOP Domain Coordinates for d1m3ua_:

Click to download the PDB-style file with coordinates for d1m3ua_.
(The format of our PDB-style files is described here.)

Timeline for d1m3ua_: