Lineage for d1m3ga_ (1m3g A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 698670Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423
  4. 698671Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 698672Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins)
  6. 698682Protein Mapk phosphatase [52803] (2 species)
  7. 698683Species Human (Homo sapiens), pac-1 [TaxId:9606] [75232] (1 PDB entry)
  8. 698684Domain d1m3ga_: 1m3g A: [84783]
    mutant

Details for d1m3ga_

PDB Entry: 1m3g (more details)

PDB Description: solution structure of the catalytic domain of mapk phosphatase pac-1: insights into substrate-induced enzymatic activation
PDB Compounds: (A:) dual specificity protein phosphatase 2

SCOP Domain Sequences for d1m3ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]}
qggpveilpylflgscshssdlqglqacgitavlnvsascpnhfeglfryksipvednqm
veisawfqeaigfidwvknsggrvlvhsqagisrsaticlaylmqsrrvrldeafdfvkq
rrgvispnfsfmgqllqfetqvlch

SCOP Domain Coordinates for d1m3ga_:

Click to download the PDB-style file with coordinates for d1m3ga_.
(The format of our PDB-style files is described here.)

Timeline for d1m3ga_: