Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (5 families) share with the family I the common active site structure with a circularly permuted topology |
Family c.45.1.1: Dual specificity phosphatase-like [52800] (8 proteins) |
Protein Mapk phosphatase [52803] (2 species) |
Species Human (Homo sapiens), pac-1 [TaxId:9606] [75232] (1 PDB entry) |
Domain d1m3ga_: 1m3g A: [84783] mutant |
PDB Entry: 1m3g (more details)
SCOP Domain Sequences for d1m3ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1 [TaxId: 9606]} qggpveilpylflgscshssdlqglqacgitavlnvsascpnhfeglfryksipvednqm veisawfqeaigfidwvknsggrvlvhsqagisrsaticlaylmqsrrvrldeafdfvkq rrgvispnfsfmgqllqfetqvlch
Timeline for d1m3ga_: