| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1423 |
Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (3 families) ![]() share with the family I the common active site structure with a circularly permuted topology |
| Family c.45.1.1: Dual specificity phosphatase-like [52800] (7 proteins) |
| Protein Mapk phosphatase [52803] (2 species) |
| Species Human (Homo sapiens), pac-1 [TaxId:9606] [75232] (1 PDB entry) |
| Domain d1m3ga_: 1m3g A: [84783] |
PDB Entry: 1m3g (more details)
SCOP Domain Sequences for d1m3ga_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m3ga_ c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), pac-1}
qggpveilpylflgscshssdlqglqacgitavlnvsascpnhfeglfryksipvednqm
veisawfqeaigfidwvknsggrvlvhsqagisrsaticlaylmqsrrvrldeafdfvkq
rrgvispnfsfmgqllqfetqvlch
Timeline for d1m3ga_: