SCOPe 2.06: Domain d1m39a_: 1m39 A:

Lineage for d1m39a_ (1m39 A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.39: EF Hand-like [47472] (4 superfamilies)
   core: 4 helices; array of 2 hairpins, opened

4. Superfamily a.39.1: EF-hand [47473] (12 families)
   Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop

5. Family a.39.1.5: Calmodulin-like [47502] (24 proteins)
   Duplication: made with two pairs of EF-hands

6. Protein Caltractin (centrin 2) [89053] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89054] (1 PDB entry)

8. Domain d1m39a_: 1m39 A: [84782]
   C-terminal domain

Details for d1m39a_

PDB Entry: 1m39

PDB Description: solution structure of the c-terminal fragment (f86-i165) of the human centrin 2 in calcium saturated form

PDB Compounds: (A:) Caltractin, isoform 1

SCOPe Domain Sequences for d1m39a_:

Sequence; same for both SEQRES and ATOM records:

>d1m39a_ a.39.1.5 (A:) Caltractin (centrin 2) {Human (Homo sapiens) [TaxId: 9606]}
fgdfltvmtqkmsekdtkeeilkafklfdddetgkisfknlkrvakelgenltdeelqem
ideadrdgdgevseqeflri

Timeline for d1m39a_:

• d1m39a_ first appeared in SCOP 1.65
  
• d1m39a_ appears in SCOPe 2.05
  
• d1m39a_ appears in SCOPe 2.07
  
• d1m39a_ appears in the current release, SCOPe 2.08