Lineage for d1m35f2 (1m35 F:177-440)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 510692Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 510693Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 510694Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 510695Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 510699Species Escherichia coli [TaxId:562] [55929] (5 PDB entries)
  8. 510708Domain d1m35f2: 1m35 F:177-440 [84781]
    Other proteins in same PDB: d1m35a1, d1m35b1, d1m35c1, d1m35d1, d1m35e1, d1m35f1

Details for d1m35f2

PDB Entry: 1m35 (more details), 2.4 Å

PDB Description: Aminopeptidase P from Escherichia coli

SCOP Domain Sequences for d1m35f2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m35f2 d.127.1.1 (F:177-440) Aminopeptidase P, C-terminal domain {Escherichia coli}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaarkq

SCOP Domain Coordinates for d1m35f2:

Click to download the PDB-style file with coordinates for d1m35f2.
(The format of our PDB-style files is described here.)

Timeline for d1m35f2: