Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families) |
Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins) |
Protein Aminopeptidase P [53096] (2 species) synonym: Xaa-Pro dipeptidase, prolidase |
Species Escherichia coli [TaxId:562] [53097] (19 PDB entries) |
Domain d1m35d1: 1m35 D:1-176 [84776] Other proteins in same PDB: d1m35a2, d1m35b2, d1m35c2, d1m35d2, d1m35e2, d1m35f2 complexed with mn |
PDB Entry: 1m35 (more details), 2.4 Å
SCOPe Domain Sequences for d1m35d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m35d1 c.55.2.1 (D:1-176) Aminopeptidase P {Escherichia coli [TaxId: 562]} seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk
Timeline for d1m35d1: