Lineage for d1m35d1 (1m35 D:1-176)

  1. Root: SCOP 1.71
  2. 570216Class c: Alpha and beta proteins (a/b) [51349] (134 folds)
  3. 586264Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 586622Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) (S)
  5. 586623Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins)
  6. 586624Protein Aminopeptidase P [53096] (2 species)
    synonym: Xaa-Pro dipeptidase, prolidase
  7. 586628Species Escherichia coli [TaxId:562] [53097] (5 PDB entries)
  8. 586635Domain d1m35d1: 1m35 D:1-176 [84776]
    Other proteins in same PDB: d1m35a2, d1m35b2, d1m35c2, d1m35d2, d1m35e2, d1m35f2

Details for d1m35d1

PDB Entry: 1m35 (more details), 2.4 Å

PDB Description: Aminopeptidase P from Escherichia coli

SCOP Domain Sequences for d1m35d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m35d1 c.55.2.1 (D:1-176) Aminopeptidase P {Escherichia coli}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

SCOP Domain Coordinates for d1m35d1:

Click to download the PDB-style file with coordinates for d1m35d1.
(The format of our PDB-style files is described here.)

Timeline for d1m35d1: