Lineage for d1m2xc_ (1m2x C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996745Species Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId:238] [90049] (1 PDB entry)
  8. 2996748Domain d1m2xc_: 1m2x C: [84766]
    complexed with gol, mco, na, zn

Details for d1m2xc_

PDB Entry: 1m2x (more details), 1.5 Å

PDB Description: Crystal Structure of the metallo-beta-lactamase BlaB of Chryseobacterium meningosepticum in complex with the inhibitor D-captopril
PDB Compounds: (C:) class B carbapenemase BlaB-1

SCOPe Domain Sequences for d1m2xc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2xc_ d.157.1.1 (C:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]}
dvkieklkdnlyvyttyntfngtkyaanavylvtdkgvvvidcpwgedkfksftdeiykk
hgkkvimniathshddraggleyfgkigaktystkmtdsilakenkpraqytfdnnksfk
vgksefqvyypgkghtadnvvvwfpkekvlvggciiksadskdlgyigeayvndwtqsvh
niqqkfsgaqyvvaghddwkdqrsiqhtldlineyqq

SCOPe Domain Coordinates for d1m2xc_:

Click to download the PDB-style file with coordinates for d1m2xc_.
(The format of our PDB-style files is described here.)

Timeline for d1m2xc_: