Lineage for d1m2xa_ (1m2x A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1224490Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 1224491Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 1224492Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 1224493Protein Zn metallo-beta-lactamase [56283] (11 species)
  7. 1224551Species Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId:238] [90049] (1 PDB entry)
  8. 1224552Domain d1m2xa_: 1m2x A: [84764]
    complexed with gol, mco, na, zn

Details for d1m2xa_

PDB Entry: 1m2x (more details), 1.5 Å

PDB Description: Crystal Structure of the metallo-beta-lactamase BlaB of Chryseobacterium meningosepticum in complex with the inhibitor D-captopril
PDB Compounds: (A:) class B carbapenemase BlaB-1

SCOPe Domain Sequences for d1m2xa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2xa_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Chryseobacterium meningosepticum, carbapenemase BLAB-1 [TaxId: 238]}
dvkieklkdnlyvyttyntfngtkyaanavylvtdkgvvvidcpwgedkfksftdeiykk
hgkkvimniathshddraggleyfgkigaktystkmtdsilakenkpraqytfdnnksfk
vgksefqvyypgkghtadnvvvwfpkekvlvggciiksadskdlgyigeayvndwtqsvh
niqqkfsgaqyvvaghddwkdqrsiqhtldlineyqqkq

SCOPe Domain Coordinates for d1m2xa_:

Click to download the PDB-style file with coordinates for d1m2xa_.
(The format of our PDB-style files is described here.)

Timeline for d1m2xa_: