Lineage for d1m2tb2 (1m2t B:385-510)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 560566Fold b.42: beta-Trefoil [50352] (8 superfamilies)
    barrel, closed; n=6, S=12; and a hairpin triplet; meander
    duplication: has internal pseudo threefold symmetry
  4. 560747Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) (S)
  5. 560748Family b.42.2.1: Ricin B-like [50371] (7 proteins)
  6. 560767Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
    duplication: consists of two domains of this fold
  7. 560778Species European mistletoe (Viscum album) [TaxId:3972] [50375] (10 PDB entries)
    different sequence variants
  8. 560780Domain d1m2tb2: 1m2t B:385-510 [84763]
    Other proteins in same PDB: d1m2ta_
    complexed with ade, fuc, gol, nag

Details for d1m2tb2

PDB Entry: 1m2t (more details), 1.89 Å

PDB Description: mistletoe lectin i from viscum album in complex with adenine monophosphate. crystal structure at 1.9 a resolution

SCOP Domain Sequences for d1m2tb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)}
taprettiygfrdlcmesaggsvyvetctagqenqrwalygdgsirpkqlqsqcltngrd
sistvinivscsagssgqrwvftnegailnlknglamdvaqanpslqriiiypatgnpnq
mwlpvp

SCOP Domain Coordinates for d1m2tb2:

Click to download the PDB-style file with coordinates for d1m2tb2.
(The format of our PDB-style files is described here.)

Timeline for d1m2tb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1m2tb1
View in 3D
Domains from other chains:
(mouse over for more information)
d1m2ta_