Class b: All beta proteins [48724] (149 folds) |
Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (3 families) |
Family b.42.2.1: Ricin B-like [50371] (7 proteins) |
Protein Plant cytotoxin B-chain (lectin) [50372] (5 species) duplication: consists of two domains of this fold |
Species European mistletoe (Viscum album) [TaxId:3972] [50375] (10 PDB entries) different sequence variants |
Domain d1m2tb2: 1m2t B:385-510 [84763] Other proteins in same PDB: d1m2ta_ complexed with ade, fuc, gol, nag |
PDB Entry: 1m2t (more details), 1.89 Å
SCOP Domain Sequences for d1m2tb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1m2tb2 b.42.2.1 (B:385-510) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album)} taprettiygfrdlcmesaggsvyvetctagqenqrwalygdgsirpkqlqsqcltngrd sistvinivscsagssgqrwvftnegailnlknglamdvaqanpslqriiiypatgnpnq mwlpvp
Timeline for d1m2tb2: