SCOPe 2.01: Domain d1m2tb1: 1m2t B:249-384

Lineage for d1m2tb1 (1m2t B:249-384)

1. Root: SCOPe 2.01

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (3 families)

5. Family b.42.2.1: Ricin B-like [50371] (11 proteins)

6. Protein Plant cytotoxin B-chain (lectin) [50372] (5 species)
   duplication: consists of two domains of this fold

7. Species European mistletoe (Viscum album) [TaxId:3972] [50375] (14 PDB entries)
   different sequence variants
   Uniprot Q6ITZ3 266-520; Uniprot P81446 269-531 # 91% sequence identity

8. Domain d1m2tb1: 1m2t B:249-384 [84762]
   Other proteins in same PDB: d1m2ta_
   complexed with ade, fuc, gol, nag

Details for d1m2tb1

PDB Entry: 1m2t, 1.89 Å

PDB Description: mistletoe lectin i from viscum album in complex with adenine monophosphate. crystal structure at 1.9 a resolution

PDB Compounds: (B:) mistletoe lectin I B chain

SCOPe Domain Sequences for d1m2tb1:

Sequence; same for both SEQRES and ATOM records:

>d1m2tb1 b.42.2.1 (B:249-384) Plant cytotoxin B-chain (lectin) {European mistletoe (Viscum album) [TaxId: 3972]}
avtctasepivrivgrngmtvdvrdddfhdgnqiqlwpsksnndpnqlwtikkdgtirsn
gsclttygytagvyvmifdcntavreatiwqiwgngtiinprsnlvlaassgikgttltv
qtldytlgqgwlagnd

Timeline for d1m2tb1:

• d1m2tb1 first appeared in SCOP 1.65
  
• d1m2tb1 appears in SCOP 1.75
  
• d1m2tb1 appears in SCOPe 2.02
  
• d1m2tb1 appears in the current release, SCOPe 2.08